PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462889327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 221aa    MW: 24706.1 Da    PI: 7.5433
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462889327genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-091561882355
                SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  462889327 156 PYPTEEDKVRLASMTGLDPKQINNWFINQRKRH 188
                8*****************************885 PP

2ELK33.77.9e-12108129122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK++Ll+KYsg+L+ L++EF+
  462889327 108 ELKEMLLKKYSGCLSRLRSEFL 129
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-63777IPR005540KNOX1
PfamPF037907.3E-113961IPR005540KNOX1
PROSITE profilePS5121310.423108128IPR005539ELK domain
PfamPF037899.2E-9108129IPR005539ELK domain
SMARTSM011883.6E-6108129IPR005539ELK domain
PROSITE profilePS5007112.455128191IPR001356Homeobox domain
SuperFamilySSF466894.71E-20130199IPR009057Homeodomain-like
SMARTSM003894.2E-14130195IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-27133193IPR009057Homeodomain-like
CDDcd000862.11E-13140192No hitNo description
PfamPF059205.2E-17148187IPR008422Homeobox KN domain
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MEDLYSIHPG ISRVGGAASE ASIVGVGSGP SSADLTELMK AQIASHPRYP SLLSAYIECR  60
KGQIVSMQMG CTAVRDEMMV SSEDEQCSGD TDVADMGQEH SSRLADHELK EMLLKKYSGC  120
LSRLRSEFLK KRKKGKLPKD ARLVLLDWWN THYRWPYPTE EDKVRLASMT GLDPKQINNW  180
FINQRKRHWK PSEDMRFALM EGVAGGSSGT TLYFDTGTIG P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123132LRSEFLKKRK
2129133KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9661181e-143EU966118.1 Zea mays clone 291871 homeobox protein OSH1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967561.11e-101PREDICTED: homeobox protein knotted-1-like 1
SwissprotA2Y0073e-88KNOSA_ORYSI; Homeobox protein knotted-1-like 10
SwissprotQ7GDL53e-88KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBLB9FM991e-102B9FM99_ORYSJ; Uncharacterized protein
STRINGGRMZM2G087741_P011e-97(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.23e-42KNOTTED1-like homeobox gene 6